PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0102200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 282aa    MW: 30146.2 Da    PI: 8.4204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0102200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++  G g+W+t ++  g+ R++k+c++rw +yl
   Spipo4G0102200 14 KGAWTKEEDQRLIAYIRANGEGCWRTLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.92.7e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
   Spipo4G0102200  67 RGNFTEEEDELIIKLHAMLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.239961IPR017930Myb domain
SuperFamilySSF466894.31E-2913108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002494.0E-141461IPR001005SANT/Myb domain
CDDcd001671.04E-91661No hitNo description
PROSITE profilePS5129429.60662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2865116IPR009057Homeodomain-like
SMARTSM007172.8E-1866114IPR001005SANT/Myb domain
PfamPF002491.4E-1767111IPR001005SANT/Myb domain
CDDcd001678.07E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIR ANGEGCWRTL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHAMLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
LDPQTHRPIG AVPAASMGVA AVAPRGLSFI ADAAKAAAAA AVKMAAESAE ERNGSAASME  180
DECSPGLNLE LSISLPFYAS KPSSSSTEAS SSMTTNTAAA TSDSTAAVAA AESAHKPYAQ  240
AICLCPNLGF QRSEACSCHG VSDPHAIRFF IPLQGGHHVL D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30141167108B-MYB
1h8a_C7e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008799190.11e-116PREDICTED: myb-related protein 308-like
SwissprotP813932e-94MYB08_ANTMA; Myb-related protein 308
TrEMBLQ6SL451e-113Q6SL45_TRAFL; MYB6
STRINGSb03g041360.11e-102(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.16e-89myb domain protein 4